PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004496857.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family M-type_MADS
Protein Properties Length: 175aa    MW: 20645.9 Da    PI: 8.0346
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004496857.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF68.37.2e-222067249
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    + e +sn+qvtfskRr g++KK +EL++LC+++va+i+fs+ +kl+ +
  XP_004496857.1 20 KLEKDSNKQVTFSKRRSGLFKKVSELCILCNVNVAIIVFSPADKLFCF 67
                    57899***************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006625.1471171IPR002100Transcription factor, MADS-box
SMARTSM004322.7E-301170IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.53E-271291IPR002100Transcription factor, MADS-box
PRINTSPR004044.2E-201333IPR002100Transcription factor, MADS-box
PfamPF003191.5E-222167IPR002100Transcription factor, MADS-box
PRINTSPR004044.2E-203348IPR002100Transcription factor, MADS-box
PRINTSPR004044.2E-204869IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MNMFHQKKKT TGRKKIEIKK LEKDSNKQVT FSKRRSGLFK KVSELCILCN VNVAIIVFSP  60
ADKLFCFGQP NTDTILKSYL EGTTEFEHSK LTENSSTYEE YNREYEEALK GLEIEKKKMV  120
EVENLAKVWN KGDWWNEPID DMSREELEQF MVSIYELRRK LLERLDGLVM MLAML
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A7e-161281170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B7e-161281170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C7e-161281170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D7e-161281170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_P7e-161281271Myocyte-specific enhancer factor 2B
1tqe_Q7e-161281271Myocyte-specific enhancer factor 2B
1tqe_R7e-161281271Myocyte-specific enhancer factor 2B
1tqe_S7e-161281271Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004496857.11e-127PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLA0A072VC913e-87A0A072VC91_MEDTR; Agamous-like MADS-box protein AGL62
STRINGGLYMA20G27361.13e-71(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-37AGAMOUS-like 62